GLP-1 “S” 10mg

Pricing & Availability

  • Product Code: WLC-GLP1S-10

  • Pack Size: 10 mg vial

  • Purity: ≥99% (HPLC verified)

  • Form: Lyophilized peptide (Research grade)

  • Availability: In Stock

  • MOQ: 1 vial

  • Shipping: 3–5 business days worldwide

📧 For OEM labeling, institutional supply, or bulk pricing inquiries:
info@westlabchemicals.com

79.99 $

GLP-1 “S” 10mg | Glucagon-Like Peptide-1 Analog | Metabolic & Diabetes Research | West Lab Chemicals


Product Overview

GLP-1 “S” (Glucagon-Like Peptide-1 Analog) is a synthetic, research-grade peptide analog of the natural incretin hormone GLP-1, known for its critical role in glucose metabolism, insulin secretion, and appetite regulation.

At West Lab Chemicals, we supply GLP-1 “S” 10mg (Research Grade) with ≥99% purity (HPLC & MS verified), manufactured under GMP-certified facilities for precision, purity, and consistency.

GLP-1 “S” is extensively used in endocrine and metabolic research, particularly in studies exploring diabetes mechanisms, weight management, pancreatic β-cell signaling, and neuroendocrine function.


What is GLP-1 “S”?

GLP-1 “S” is a stable synthetic analog of Glucagon-Like Peptide-1, an incretin hormone produced in the intestinal L-cells that regulates glucose homeostasis.

This analog mimics the biological effects of natural GLP-1 but with improved resistance to enzymatic degradation (DPP-IV), giving it a longer half-life for extended receptor activity in laboratory conditions.

Mechanism of Action:

  • Binds to GLP-1 receptors (GLP-1R) in the pancreas, brain, and GI tract.

  • Enhances insulin secretion in glucose-dependent manner.

  • Inhibits glucagon release.

  • Delays gastric emptying.

  • Reduces appetite and food intake via hypothalamic regulation.


Key Features

✅ ≥99% purity verified by HPLC & Mass Spectrometry
✅ Synthetic analog with enhanced stability and bioavailability
✅ Mimics natural GLP-1 hormone activity
✅ Supports insulin secretion and glucose regulation research
✅ Non-hormonal, receptor-mediated peptide mechanism
✅ GMP-certified and batch-documented


Benefits (Research Context)

⚙️ Insulin Secretion Studies: Promotes glucose-stimulated insulin release.
⚙️ Glucagon Regulation: Reduces glucagon secretion in hyperglycemia models.
⚙️ Metabolic Research: Helps study mechanisms of fat oxidation and appetite suppression.
⚙️ Diabetes & Obesity Models: Used in type 2 diabetes and weight regulation experiments.
⚙️ Neuroendocrine Studies: Supports appetite and satiety pathway research.


Applications / Uses (Research Only)

🔹 Diabetes and glucose metabolism studies
🔹 Appetite and weight control research
🔹 Pancreatic β-cell regeneration models
🔹 Endocrine hormone signaling experiments
🔹 Neuroendocrine function and satiety studies


Composition & Technical Data

Property Specification
Chemical Name GLP-1 “S” (Glucagon-Like Peptide-1 Analog)
Synonyms GLP-1 Synthetic Analog, Glucagon-Like Peptide-1 Mimetic
Sequence HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH₂ (modified for stability)
CAS Number N/A (research analog)
Molecular Formula C₁₆₅H₂₆₃N₄₃O₅₅
Molecular Weight ~3750 g/mol
Appearance White to off-white lyophilized powder
Purity ≥99% (HPLC verified)
Solubility Soluble in sterile or bacteriostatic water
Form Lyophilized powder (Research grade)
Storage Conditions –20 °C, dry and dark
Pack Size 10 mg vial

Dosage & Usage (Research Context)

  • Reconstitution: Dissolve in sterile or bacteriostatic water.

  • Recommended concentration: As required by study protocol.

  • Storage after reconstitution: Store aliquots at –20 °C.

  • Handling: Avoid multiple freeze–thaw cycles.

  • Note: For in vitro and laboratory research onlynot for injection or ingestion.


Storage & Stability

  • Store lyophilized GLP-1 “S” at –20 °C for long-term preservation.

  • After reconstitution, store at 2–8 °C for up to 30 days.

  • Protect from light, humidity, and temperature variation.

  • Handle aseptically to preserve integrity.


Safety & Handling

  • Intended for scientific and laboratory research use only.

  • Not for human or veterinary use.

  • Avoid inhalation or direct contact.

  • Use protective gloves and laboratory PPE.

  • Dispose of waste according to institutional biosafety guidelines.


Why Buy from West Lab Chemicals?

🌐 High Purity: ≥99% verified by HPLC and MS.
🧪 GMP Manufacturing: Ensures reliable and reproducible quality.
📄 COA & MSDS Included: Documentation provided with each vial.
🚚 Global Shipping: Temperature-controlled and tracked worldwide.
💬 Technical Support: Assistance for peptide handling and solubility.
💧 Trusted Worldwide: Preferred by metabolic and endocrine researchers.


Purity Guarantee

Every vial of GLP-1 “S” 10mg from West Lab Chemicals is:

  • ≥99% pure (HPLC and MS verified)

  • Tested for sterility and endotoxins

  • COA batch-certified and traceable

  • Manufactured under GMP & ISO 9001:2015 standards

Customer Reviews

0 reviews
0
0
0
0
0

There are no reviews yet.

Be the first to review “GLP-1 “S” 10mg”

Your email address will not be published. Required fields are marked *