GLP-1 “S” 10mg | Glucagon-Like Peptide-1 Analog | Metabolic & Diabetes Research | West Lab Chemicals
Product Overview
GLP-1 “S” (Glucagon-Like Peptide-1 Analog) is a synthetic, research-grade peptide analog of the natural incretin hormone GLP-1, known for its critical role in glucose metabolism, insulin secretion, and appetite regulation.
At West Lab Chemicals, we supply GLP-1 “S” 10mg (Research Grade) with ≥99% purity (HPLC & MS verified), manufactured under GMP-certified facilities for precision, purity, and consistency.
GLP-1 “S” is extensively used in endocrine and metabolic research, particularly in studies exploring diabetes mechanisms, weight management, pancreatic β-cell signaling, and neuroendocrine function.
What is GLP-1 “S”?
GLP-1 “S” is a stable synthetic analog of Glucagon-Like Peptide-1, an incretin hormone produced in the intestinal L-cells that regulates glucose homeostasis.
This analog mimics the biological effects of natural GLP-1 but with improved resistance to enzymatic degradation (DPP-IV), giving it a longer half-life for extended receptor activity in laboratory conditions.
Mechanism of Action:
-
Binds to GLP-1 receptors (GLP-1R) in the pancreas, brain, and GI tract.
-
Enhances insulin secretion in glucose-dependent manner.
-
Inhibits glucagon release.
-
Delays gastric emptying.
-
Reduces appetite and food intake via hypothalamic regulation.
Key Features
✅ ≥99% purity verified by HPLC & Mass Spectrometry
✅ Synthetic analog with enhanced stability and bioavailability
✅ Mimics natural GLP-1 hormone activity
✅ Supports insulin secretion and glucose regulation research
✅ Non-hormonal, receptor-mediated peptide mechanism
✅ GMP-certified and batch-documented
Benefits (Research Context)
⚙️ Insulin Secretion Studies: Promotes glucose-stimulated insulin release.
⚙️ Glucagon Regulation: Reduces glucagon secretion in hyperglycemia models.
⚙️ Metabolic Research: Helps study mechanisms of fat oxidation and appetite suppression.
⚙️ Diabetes & Obesity Models: Used in type 2 diabetes and weight regulation experiments.
⚙️ Neuroendocrine Studies: Supports appetite and satiety pathway research.
Applications / Uses (Research Only)
🔹 Diabetes and glucose metabolism studies
🔹 Appetite and weight control research
🔹 Pancreatic β-cell regeneration models
🔹 Endocrine hormone signaling experiments
🔹 Neuroendocrine function and satiety studies
Composition & Technical Data
| Property | Specification |
|---|---|
| Chemical Name | GLP-1 “S” (Glucagon-Like Peptide-1 Analog) |
| Synonyms | GLP-1 Synthetic Analog, Glucagon-Like Peptide-1 Mimetic |
| Sequence | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH₂ (modified for stability) |
| CAS Number | N/A (research analog) |
| Molecular Formula | C₁₆₅H₂₆₃N₄₃O₅₅ |
| Molecular Weight | ~3750 g/mol |
| Appearance | White to off-white lyophilized powder |
| Purity | ≥99% (HPLC verified) |
| Solubility | Soluble in sterile or bacteriostatic water |
| Form | Lyophilized powder (Research grade) |
| Storage Conditions | –20 °C, dry and dark |
| Pack Size | 10 mg vial |
Dosage & Usage (Research Context)
-
Reconstitution: Dissolve in sterile or bacteriostatic water.
-
Recommended concentration: As required by study protocol.
-
Storage after reconstitution: Store aliquots at –20 °C.
-
Handling: Avoid multiple freeze–thaw cycles.
-
Note: For in vitro and laboratory research only — not for injection or ingestion.
Storage & Stability
-
Store lyophilized GLP-1 “S” at –20 °C for long-term preservation.
-
After reconstitution, store at 2–8 °C for up to 30 days.
-
Protect from light, humidity, and temperature variation.
-
Handle aseptically to preserve integrity.
Safety & Handling
-
Intended for scientific and laboratory research use only.
-
Not for human or veterinary use.
-
Avoid inhalation or direct contact.
-
Use protective gloves and laboratory PPE.
-
Dispose of waste according to institutional biosafety guidelines.
Why Buy from West Lab Chemicals?
🌐 High Purity: ≥99% verified by HPLC and MS.
🧪 GMP Manufacturing: Ensures reliable and reproducible quality.
📄 COA & MSDS Included: Documentation provided with each vial.
🚚 Global Shipping: Temperature-controlled and tracked worldwide.
💬 Technical Support: Assistance for peptide handling and solubility.
💧 Trusted Worldwide: Preferred by metabolic and endocrine researchers.
Purity Guarantee
Every vial of GLP-1 “S” 10mg from West Lab Chemicals is:
-
≥99% pure (HPLC and MS verified)
-
Tested for sterility and endotoxins
-
COA batch-certified and traceable
-
Manufactured under GMP & ISO 9001:2015 standards

Reviews
Clear filtersThere are no reviews yet.