GLP-1 “S” 30mg

Pricing & Availability

  • Product Code: WLC-GLP1S-30

  • Pack Size: 30 mg vial

  • Purity: ≥99% (HPLC verified)

  • Form: Lyophilized peptide (Research grade)

  • Availability: In Stock

  • MOQ: 1 vial

  • Shipping: 3–5 business days worldwide

📧 For bulk pricing, OEM labeling, or institutional research supply:
info@westlabchemicals.com

189.99 $

GLP-1 “S” 30mg | Glucagon-Like Peptide-1 Analog | Glucose & Metabolic Research 

GLP-1 “S” (Glucagon-Like Peptide-1 Analog) is a synthetic incretin peptide analog designed to replicate the biological activity of the natural hormone GLP-1, a key regulator of insulin secretion, glucose metabolism, and appetite control.

At West Lab Chemicals, we supply GLP-1 “S” 30mg (Research Grade) with ≥99% purity (HPLC & MS verified), produced in GMP-certified laboratories for exceptional consistency, purity, and stability.

This peptide is widely used in diabetes, obesity, and metabolic research, helping scientists investigate insulin signaling, glucagon suppression, and cellular energy regulation mechanisms.


What is GLP-1 “S”?

GLP-1 “S” is a stable, long-acting synthetic analog of Glucagon-Like Peptide-1 (GLP-1), which is naturally produced by intestinal L-cells in response to food intake.

The peptide activates GLP-1 receptors (GLP-1R) on pancreatic β-cells, brain, and gastrointestinal tissues — promoting insulin secretion, suppressing glucagon, and enhancing satiety signals.

Its modified structure provides enhanced resistance to enzymatic degradation (DPP-IV), ensuring longer biological activity in in vitro and in vivo research models.


Mechanism of Action

  • Binds to GLP-1R (Glucagon-Like Peptide-1 Receptors)

  • Promotes glucose-dependent insulin release

  • Inhibits glucagon secretion from α-cells

  • Delays gastric emptying and supports appetite suppression

  • Enhances β-cell proliferation and survival in experimental studies


Key Features

✅ ≥99% purity verified via HPLC & MS
✅ Synthetic GLP-1 analog with extended stability
✅ Mimics natural incretin hormone function
✅ Supports insulin and glucose regulation research
✅ Manufactured under GMP & ISO 9001 standards
✅ COA & MSDS provided with every batch


Benefits (Research Context)

⚙️ Insulin Regulation Studies: Promotes glucose-stimulated insulin secretion.
⚙️ Metabolic Research: Used in obesity and energy expenditure experiments.
⚙️ β-Cell Function: Enhances pancreatic cell survival and proliferation (in research models).
⚙️ Appetite Regulation: Demonstrates satiety-related signaling in hypothalamic pathways.
⚙️ Glucose Homeostasis: Reduces postprandial glucose levels in test models.


Applications / Uses (Research Only)

🔹 Diabetes and glucose metabolism research
🔹 Obesity and appetite regulation studies
🔹 Endocrine and pancreatic function modeling
🔹 GLP-1 receptor activation and signal transduction research
🔹 β-cell regeneration and insulin signaling experiments


Composition & Technical Data

Property Specification
Chemical Name GLP-1 “S” (Glucagon-Like Peptide-1 Analog)
Synonyms GLP-1 Synthetic Analog, Glucagon-Like Peptide-1 Mimetic
Sequence HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH₂ (stabilized analog)
CAS Number N/A (research analog)
Molecular Formula C₁₆₅H₂₆₃N₄₃O₅₅
Molecular Weight ~3750 g/mol
Appearance White to off-white lyophilized powder
Purity ≥99% (HPLC verified)
Solubility Soluble in sterile or bacteriostatic water
Form Lyophilized peptide (Research grade)
Storage Conditions –20 °C, dry and dark
Pack Size 30 mg vial

Dosage & Usage (Research Context)

  • Reconstitution: Dissolve in sterile or bacteriostatic water.

  • Recommended concentration: Determined by experimental protocol.

  • Storage after reconstitution: Store aliquots at –20 °C.

  • Handling: Avoid repeated freeze–thaw cycles.

  • Note: For in vitro and laboratory research use onlynot for injection or ingestion.


Storage & Stability

  • Store lyophilized GLP-1 “S” at –20 °C for long-term preservation.

  • After reconstitution, refrigerate (2–8 °C) and use within 30 days.

  • Protect from direct sunlight, humidity, and high temperatures.

  • Maintain sterile handling to ensure purity.


Safety & Handling

  • For scientific and laboratory research use only.

  • Not for human or veterinary use.

  • Avoid inhalation or direct skin contact.

  • Use gloves, safety goggles, and PPE when handling.

  • Dispose of materials according to institutional biosafety standards.


Why Buy from West Lab Chemicals?

🌐 Verified Purity: ≥99% tested via HPLC & MS.
🧪 GMP Manufacturing: Ensures reproducibility and sterility.
📄 Complete Documentation: COA & MSDS with every vial.
🚚 Worldwide Delivery: Temperature-controlled global shipping.
💬 Technical Assistance: Support for peptide reconstitution and stability.
💧 Trusted by Researchers: Preferred for metabolic and GLP-1 receptor studies.


Purity Guarantee

Each GLP-1 “S” 30mg batch from West Lab Chemicals undergoes:

  • ≥99% purity verification via HPLC and MS

  • Microbial and endotoxin testing

  • Batch-specific COA and traceability certification

  • GMP & ISO 9001:2015 compliant manufacturing

Customer Reviews

0 reviews
0
0
0
0
0

There are no reviews yet.

Be the first to review “GLP-1 “S” 30mg”

Your email address will not be published. Required fields are marked *