GLP-1 “S” 30mg | Glucagon-Like Peptide-1 Analog | Glucose & Metabolic Research
GLP-1 “S” (Glucagon-Like Peptide-1 Analog) is a synthetic incretin peptide analog designed to replicate the biological activity of the natural hormone GLP-1, a key regulator of insulin secretion, glucose metabolism, and appetite control.
At West Lab Chemicals, we supply GLP-1 “S” 30mg (Research Grade) with ≥99% purity (HPLC & MS verified), produced in GMP-certified laboratories for exceptional consistency, purity, and stability.
This peptide is widely used in diabetes, obesity, and metabolic research, helping scientists investigate insulin signaling, glucagon suppression, and cellular energy regulation mechanisms.
What is GLP-1 “S”?
GLP-1 “S” is a stable, long-acting synthetic analog of Glucagon-Like Peptide-1 (GLP-1), which is naturally produced by intestinal L-cells in response to food intake.
The peptide activates GLP-1 receptors (GLP-1R) on pancreatic β-cells, brain, and gastrointestinal tissues — promoting insulin secretion, suppressing glucagon, and enhancing satiety signals.
Its modified structure provides enhanced resistance to enzymatic degradation (DPP-IV), ensuring longer biological activity in in vitro and in vivo research models.
Mechanism of Action
-
Binds to GLP-1R (Glucagon-Like Peptide-1 Receptors)
-
Promotes glucose-dependent insulin release
-
Inhibits glucagon secretion from α-cells
-
Delays gastric emptying and supports appetite suppression
-
Enhances β-cell proliferation and survival in experimental studies
Key Features
✅ ≥99% purity verified via HPLC & MS
✅ Synthetic GLP-1 analog with extended stability
✅ Mimics natural incretin hormone function
✅ Supports insulin and glucose regulation research
✅ Manufactured under GMP & ISO 9001 standards
✅ COA & MSDS provided with every batch
Benefits (Research Context)
⚙️ Insulin Regulation Studies: Promotes glucose-stimulated insulin secretion.
⚙️ Metabolic Research: Used in obesity and energy expenditure experiments.
⚙️ β-Cell Function: Enhances pancreatic cell survival and proliferation (in research models).
⚙️ Appetite Regulation: Demonstrates satiety-related signaling in hypothalamic pathways.
⚙️ Glucose Homeostasis: Reduces postprandial glucose levels in test models.
Applications / Uses (Research Only)
🔹 Diabetes and glucose metabolism research
🔹 Obesity and appetite regulation studies
🔹 Endocrine and pancreatic function modeling
🔹 GLP-1 receptor activation and signal transduction research
🔹 β-cell regeneration and insulin signaling experiments
Composition & Technical Data
| Property | Specification |
|---|---|
| Chemical Name | GLP-1 “S” (Glucagon-Like Peptide-1 Analog) |
| Synonyms | GLP-1 Synthetic Analog, Glucagon-Like Peptide-1 Mimetic |
| Sequence | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH₂ (stabilized analog) |
| CAS Number | N/A (research analog) |
| Molecular Formula | C₁₆₅H₂₆₃N₄₃O₅₅ |
| Molecular Weight | ~3750 g/mol |
| Appearance | White to off-white lyophilized powder |
| Purity | ≥99% (HPLC verified) |
| Solubility | Soluble in sterile or bacteriostatic water |
| Form | Lyophilized peptide (Research grade) |
| Storage Conditions | –20 °C, dry and dark |
| Pack Size | 30 mg vial |
Dosage & Usage (Research Context)
-
Reconstitution: Dissolve in sterile or bacteriostatic water.
-
Recommended concentration: Determined by experimental protocol.
-
Storage after reconstitution: Store aliquots at –20 °C.
-
Handling: Avoid repeated freeze–thaw cycles.
-
Note: For in vitro and laboratory research use only — not for injection or ingestion.
Storage & Stability
-
Store lyophilized GLP-1 “S” at –20 °C for long-term preservation.
-
After reconstitution, refrigerate (2–8 °C) and use within 30 days.
-
Protect from direct sunlight, humidity, and high temperatures.
-
Maintain sterile handling to ensure purity.
Safety & Handling
-
For scientific and laboratory research use only.
-
Not for human or veterinary use.
-
Avoid inhalation or direct skin contact.
-
Use gloves, safety goggles, and PPE when handling.
-
Dispose of materials according to institutional biosafety standards.
Why Buy from West Lab Chemicals?
🌐 Verified Purity: ≥99% tested via HPLC & MS.
🧪 GMP Manufacturing: Ensures reproducibility and sterility.
📄 Complete Documentation: COA & MSDS with every vial.
🚚 Worldwide Delivery: Temperature-controlled global shipping.
💬 Technical Assistance: Support for peptide reconstitution and stability.
💧 Trusted by Researchers: Preferred for metabolic and GLP-1 receptor studies.
Purity Guarantee
Each GLP-1 “S” 30mg batch from West Lab Chemicals undergoes:
-
≥99% purity verification via HPLC and MS
-
Microbial and endotoxin testing
-
Batch-specific COA and traceability certification
-
GMP & ISO 9001:2015 compliant manufacturing

Reviews
Clear filtersThere are no reviews yet.