GLP-1 “S” 5mg

Pricing & Availability

  • Product Code: WLC-GLP1S-5

  • Pack Size: 5 mg vial

  • Purity: ≥99% (HPLC verified)

  • Form: Lyophilized peptide (Research grade)

  • Availability: In Stock

  • MOQ: 1 vial

  • Shipping: 3–5 business days worldwide

📧 For bulk orders, OEM formulation, or institutional supply:
info@westlabchemicals.com

49.99 $

GLP-1 “S” 5mg | Glucagon-Like Peptide-1 Analog | Metabolic & Diabetes Research 

GLP-1 “S” (Glucagon-Like Peptide-1 Analog) is a synthetic peptide analog modeled after the naturally occurring incretin hormone GLP-1, which plays a pivotal role in glucose metabolism, insulin regulation, and appetite control.

At West Lab Chemicals, we supply GLP-1 “S” 5mg (Research Grade) with ≥99% purity (HPLC & MS verified), formulated under GMP-certified laboratory conditions to ensure unmatched stability, potency, and purity.

GLP-1 “S” is a key compound in metabolic and endocrine research, often used in studies exploring diabetes mechanisms, glucose homeostasis, appetite suppression, and insulin signaling pathways.


What is GLP-1 “S”?

GLP-1 “S” is a synthetic analog of Glucagon-Like Peptide-1 (GLP-1), a natural incretin hormone secreted by intestinal L-cells after nutrient intake.

It binds to GLP-1 receptors (GLP-1R) found in pancreatic β-cells, brain, and gastrointestinal tissue, stimulating insulin secretion and inhibiting glucagon release.

This analog is structurally stabilized to resist enzymatic degradation by DPP-IV, offering longer activity duration in research applications.


Mechanism of Action

  • Activates GLP-1R (Glucagon-Like Peptide-1 receptor) signaling cascade.

  • Promotes insulin release in a glucose-dependent manner.

  • Suppresses glucagon secretion, helping regulate blood sugar.

  • Slows gastric emptying, influencing satiety and appetite.

  • Enhances β-cell proliferation and anti-apoptotic signaling in research models.


Key Features

✅ ≥99% purity verified by HPLC & MS
✅ Synthetic analog of natural GLP-1 hormone
✅ Long-acting, DPP-IV resistant structure
✅ Supports insulin secretion and glucose regulation studies
✅ Non-hormonal, receptor-mediated mechanism
✅ Manufactured in GMP-certified facilities


Benefits (Research Context)

⚙️ Endocrine Research: Enhances insulin signaling and β-cell activation.
⚙️ Metabolic Studies: Used in glucose regulation and energy balance experiments.
⚙️ Obesity Research: Involved in appetite suppression and satiety pathway studies.
⚙️ Neuroendocrine Models: Examines GLP-1’s central effects on food intake and metabolism.
⚙️ Diabetes Studies: Valuable in models of Type 2 diabetes and insulin resistance.


Applications / Uses (Research Only)

🔹 Diabetes and glucose metabolism studies
🔹 Appetite control and satiety research
🔹 Endocrine and pancreatic β-cell function models
🔹 GLP-1 receptor activation studies
🔹 Neuroendocrine metabolic experiments


Composition & Technical Data

Property Specification
Chemical Name GLP-1 “S” (Glucagon-Like Peptide-1 Analog)
Synonyms GLP-1 Synthetic Analog, Glucagon-Like Peptide-1 Mimetic
Sequence HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH₂ (stabilized form)
CAS Number N/A (research analog)
Molecular Formula C₁₆₅H₂₆₃N₄₃O₅₅
Molecular Weight ~3750 g/mol
Appearance White to off-white lyophilized powder
Purity ≥99% (HPLC verified)
Solubility Soluble in sterile or bacteriostatic water
Form Lyophilized peptide (Research grade)
Storage Conditions –20 °C, dry and dark
Pack Size 5 mg vial

Dosage & Usage (Research Context)

  • Reconstitution: Dissolve in sterile or bacteriostatic water.

  • Concentration: Determined by study protocol.

  • Storage after reconstitution: Store aliquots at –20 °C.

  • Handling: Avoid repeated freeze–thaw cycles.

  • Note: For in vitro and scientific research onlynot for injection or ingestion.


Storage & Stability

  • Store lyophilized peptide at –20 °C for long-term preservation.

  • After reconstitution, refrigerate at 2–8 °C and use within 30 days.

  • Protect from light, moisture, and heat.

  • Handle under sterile laboratory conditions.


Safety & Handling

  • Intended for scientific and laboratory research use only.

  • Not for human or veterinary use.

  • Avoid inhalation, ingestion, or skin contact.

  • Use gloves, eye protection, and laboratory PPE.

  • Dispose of materials according to institutional biosafety standards.


Why Buy from West Lab Chemicals?

🌐 Verified Purity: ≥99% confirmed via HPLC & MS testing.
🧪 GMP Manufacturing: Ensures sterility, consistency, and traceability.
📄 COA & MSDS Provided: Full documentation with every batch.
🚚 Worldwide Shipping: Temperature-controlled and trackable.
💬 Expert Support: Technical help for peptide reconstitution and storage.
💧 Trusted Supplier: Preferred source for GLP-1 and metabolic peptide research.


Purity Guarantee

Each batch of GLP-1 “S” 5mg from West Lab Chemicals undergoes:

  • ≥99% HPLC and MS verification

  • Endotoxin and microbial testing

  • COA batch documentation

  • GMP & ISO 9001:2015 certified manufacturing

Customer Reviews

0 reviews
0
0
0
0
0

There are no reviews yet.

Be the first to review “GLP-1 “S” 5mg”

Your email address will not be published. Required fields are marked *