GLP-1 “S” 5mg | Glucagon-Like Peptide-1 Analog | Metabolic & Diabetes Research
GLP-1 “S” (Glucagon-Like Peptide-1 Analog) is a synthetic peptide analog modeled after the naturally occurring incretin hormone GLP-1, which plays a pivotal role in glucose metabolism, insulin regulation, and appetite control.
At West Lab Chemicals, we supply GLP-1 “S” 5mg (Research Grade) with ≥99% purity (HPLC & MS verified), formulated under GMP-certified laboratory conditions to ensure unmatched stability, potency, and purity.
GLP-1 “S” is a key compound in metabolic and endocrine research, often used in studies exploring diabetes mechanisms, glucose homeostasis, appetite suppression, and insulin signaling pathways.
What is GLP-1 “S”?
GLP-1 “S” is a synthetic analog of Glucagon-Like Peptide-1 (GLP-1), a natural incretin hormone secreted by intestinal L-cells after nutrient intake.
It binds to GLP-1 receptors (GLP-1R) found in pancreatic β-cells, brain, and gastrointestinal tissue, stimulating insulin secretion and inhibiting glucagon release.
This analog is structurally stabilized to resist enzymatic degradation by DPP-IV, offering longer activity duration in research applications.
Mechanism of Action
-
Activates GLP-1R (Glucagon-Like Peptide-1 receptor) signaling cascade.
-
Promotes insulin release in a glucose-dependent manner.
-
Suppresses glucagon secretion, helping regulate blood sugar.
-
Slows gastric emptying, influencing satiety and appetite.
-
Enhances β-cell proliferation and anti-apoptotic signaling in research models.
Key Features
✅ ≥99% purity verified by HPLC & MS
✅ Synthetic analog of natural GLP-1 hormone
✅ Long-acting, DPP-IV resistant structure
✅ Supports insulin secretion and glucose regulation studies
✅ Non-hormonal, receptor-mediated mechanism
✅ Manufactured in GMP-certified facilities
Benefits (Research Context)
⚙️ Endocrine Research: Enhances insulin signaling and β-cell activation.
⚙️ Metabolic Studies: Used in glucose regulation and energy balance experiments.
⚙️ Obesity Research: Involved in appetite suppression and satiety pathway studies.
⚙️ Neuroendocrine Models: Examines GLP-1’s central effects on food intake and metabolism.
⚙️ Diabetes Studies: Valuable in models of Type 2 diabetes and insulin resistance.
Applications / Uses (Research Only)
🔹 Diabetes and glucose metabolism studies
🔹 Appetite control and satiety research
🔹 Endocrine and pancreatic β-cell function models
🔹 GLP-1 receptor activation studies
🔹 Neuroendocrine metabolic experiments
Composition & Technical Data
| Property | Specification |
|---|---|
| Chemical Name | GLP-1 “S” (Glucagon-Like Peptide-1 Analog) |
| Synonyms | GLP-1 Synthetic Analog, Glucagon-Like Peptide-1 Mimetic |
| Sequence | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH₂ (stabilized form) |
| CAS Number | N/A (research analog) |
| Molecular Formula | C₁₆₅H₂₆₃N₄₃O₅₅ |
| Molecular Weight | ~3750 g/mol |
| Appearance | White to off-white lyophilized powder |
| Purity | ≥99% (HPLC verified) |
| Solubility | Soluble in sterile or bacteriostatic water |
| Form | Lyophilized peptide (Research grade) |
| Storage Conditions | –20 °C, dry and dark |
| Pack Size | 5 mg vial |
Dosage & Usage (Research Context)
-
Reconstitution: Dissolve in sterile or bacteriostatic water.
-
Concentration: Determined by study protocol.
-
Storage after reconstitution: Store aliquots at –20 °C.
-
Handling: Avoid repeated freeze–thaw cycles.
-
Note: For in vitro and scientific research only — not for injection or ingestion.
Storage & Stability
-
Store lyophilized peptide at –20 °C for long-term preservation.
-
After reconstitution, refrigerate at 2–8 °C and use within 30 days.
-
Protect from light, moisture, and heat.
-
Handle under sterile laboratory conditions.
Safety & Handling
-
Intended for scientific and laboratory research use only.
-
Not for human or veterinary use.
-
Avoid inhalation, ingestion, or skin contact.
-
Use gloves, eye protection, and laboratory PPE.
-
Dispose of materials according to institutional biosafety standards.
Why Buy from West Lab Chemicals?
🌐 Verified Purity: ≥99% confirmed via HPLC & MS testing.
🧪 GMP Manufacturing: Ensures sterility, consistency, and traceability.
📄 COA & MSDS Provided: Full documentation with every batch.
🚚 Worldwide Shipping: Temperature-controlled and trackable.
💬 Expert Support: Technical help for peptide reconstitution and storage.
💧 Trusted Supplier: Preferred source for GLP-1 and metabolic peptide research.
Purity Guarantee
Each batch of GLP-1 “S” 5mg from West Lab Chemicals undergoes:
-
≥99% HPLC and MS verification
-
Endotoxin and microbial testing
-
COA batch documentation
-
GMP & ISO 9001:2015 certified manufacturing

Reviews
Clear filtersThere are no reviews yet.