GLP-2 “TZ” 10mg | Glucagon-Like Peptide-2 Analog | Intestinal Growth & Repair Research
GLP-2 “TZ” (Glucagon-Like Peptide-2 Analog) is a synthetic research peptide modeled after the natural GLP-2 hormone, an intestinal growth factor known for promoting gut mucosal integrity, nutrient absorption, and epithelial regeneration.
At West Lab Chemicals, we supply GLP-2 “TZ” 10mg (Research Grade) with ≥99% purity (HPLC & MS verified), manufactured under GMP-certified laboratory conditions to ensure exceptional purity, stability, and reproducibility.
This peptide is extensively used in gastrointestinal, metabolic, and mucosal biology research, particularly for studying intestinal adaptation, gut permeability, and enteric regeneration mechanisms.
What is GLP-2 “TZ”?
GLP-2 “TZ” is a synthetic analog of Glucagon-Like Peptide-2, a 33-amino acid peptide hormone secreted by the enteroendocrine L-cells of the small intestine.
It plays a vital role in intestinal mucosal growth, nutrient absorption, and barrier repair by stimulating enterocyte proliferation and inhibiting apoptosis.
The “TZ” analog is structurally modified to resist DPP-IV enzymatic degradation, resulting in longer activity and enhanced stability for extended in vitro and in vivo research applications.
Mechanism of Action
-
Binds to GLP-2 receptors (GLP-2R) on intestinal epithelial cells.
-
Activates intestinal growth and repair pathways (IGF-1 and PI3K/Akt signaling).
-
Inhibits epithelial apoptosis and promotes crypt-villus regeneration.
-
Enhances nutrient absorption and strengthens mucosal barrier integrity.
-
Reduces inflammatory cytokine activity in intestinal models.
Key Features
✅ ≥99% purity verified by HPLC & MS
✅ Stable GLP-2 analog with enhanced bioactivity
✅ Supports gut mucosal regeneration and epithelial repair research
✅ Long-acting and DPP-IV–resistant structure
✅ Manufactured under GMP & ISO 9001 standards
✅ Batch-specific COA and MSDS provided
Benefits (Research Context)
⚙️ Intestinal Growth Studies: Promotes enterocyte proliferation and villus height increase.
⚙️ Mucosal Repair Research: Enhances epithelial healing and tight junction integrity.
⚙️ Nutrient Absorption Models: Improves glucose, amino acid, and lipid uptake efficiency.
⚙️ Inflammation Studies: Reduces pro-inflammatory markers in GI tissue models.
⚙️ Barrier Function Research: Strengthens intestinal permeability and cell cohesion.
Applications / Uses (Research Only)
🔹 Gastrointestinal mucosal regeneration studies
🔹 Intestinal permeability and nutrient transport research
🔹 Inflammatory bowel disease (IBD) and gut injury models
🔹 Endocrine hormone signaling studies
🔹 Epithelial and enterocyte cell growth investigations
Composition & Technical Data
| Property | Specification |
|---|---|
| Chemical Name | GLP-2 “TZ” (Glucagon-Like Peptide-2 Analog) |
| Synonyms | GLP-2 Synthetic Analog, Glucagon-Like Peptide-2 Mimetic |
| Sequence | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRG (modified for stability) |
| CAS Number | N/A (research analog) |
| Molecular Formula | C₁₆₅H₂₆₃N₄₃O₅₅ |
| Molecular Weight | ~3760 g/mol |
| Appearance | White to off-white lyophilized powder |
| Purity | ≥99% (HPLC verified) |
| Solubility | Soluble in sterile or bacteriostatic water |
| Form | Lyophilized peptide (Research grade) |
| Storage Conditions | –20 °C, dry and dark |
| Pack Size | 10 mg vial |
Dosage & Usage (Research Context)
-
Reconstitution: Dissolve in sterile or bacteriostatic water.
-
Recommended concentration: As defined by study parameters.
-
Storage after reconstitution: Store aliquots at –20 °C.
-
Handling: Avoid multiple freeze–thaw cycles.
-
Note: For in vitro and laboratory research use only — not for injection or ingestion.
Storage & Stability
-
Store lyophilized peptide at –20 °C for up to 24 months.
-
After reconstitution, refrigerate (2–8 °C) and use within 30 days.
-
Protect from light, moisture, and heat.
-
Handle aseptically to prevent contamination.
Safety & Handling
-
Intended for scientific and laboratory research use only.
-
Not for human or veterinary use.
-
Avoid inhalation or skin contact.
-
Use appropriate PPE (gloves, mask, lab coat).
-
Dispose of materials in accordance with biosafety guidelines.
Why Buy from West Lab Chemicals?
🌐 Verified Purity: ≥99% confirmed by HPLC & MS testing.
🧪 GMP-Compliant Production: Ensures reproducibility and safety.
📄 Full Documentation: COA & MSDS provided with every batch.
🚚 Worldwide Shipping: Temperature-controlled and tracked delivery.
💬 Expert Technical Support: Guidance for peptide reconstitution and storage.
💧 Trusted Worldwide: Preferred by GI, metabolic, and cellular regeneration researchers.
Purity Guarantee
Each GLP-2 “TZ” 10mg vial from West Lab Chemicals is:
-
≥99% pure (HPLC & MS verified)
-
Tested for sterility and endotoxins
-
COA batch-documented for traceability
-
Produced under GMP & ISO 9001:2015 certification

Reviews
Clear filtersThere are no reviews yet.