GLP-2 “TZ” 120mg

Pricing & Availability

  • Product Code: WLC-GLP2TZ-120

  • Pack Size: 120 mg vial

  • Purity: ≥99% (HPLC verified)

  • Form: Lyophilized peptide (Research grade)

  • Availability: In Stock

  • MOQ: 1 vial

  • Shipping: 3–5 business days worldwide

📧 For bulk pricing, OEM labeling, or institutional supply inquiries:
info@westlabchemicals.com

399.99 $

GLP-2 “TZ” 120mg | Glucagon-Like Peptide-2 Analog | Intestinal Growth & Repair Research | West Lab Chemicals


Product Overview

GLP-2 “TZ” (Glucagon-Like Peptide-2 Analog) is a synthetic analog of the naturally occurring hormone GLP-2, known for promoting intestinal mucosal regeneration, nutrient absorption, and barrier repair.

At West Lab Chemicals, we provide GLP-2 “TZ” 120mg (Research Grade) with ≥99% purity (HPLC & MS verified), produced under GMP-certified laboratory conditions for consistent purity, stability, and reproducibility.

This high-volume format is ideal for institutional and long-term gastrointestinal research, enabling extensive studies on enteric regeneration, gut permeability, and mucosal inflammation.


What is GLP-2 “TZ”?

GLP-2 “TZ” is a long-acting peptide analog of Glucagon-Like Peptide-2, a 33-amino acid hormone secreted by intestinal enteroendocrine L-cells following nutrient intake.

It acts primarily through GLP-2 receptors (GLP-2R) on intestinal epithelial cells to stimulate crypt cell proliferation, villus growth, and epithelial repair, improving the overall structure and function of the gastrointestinal tract.

The “TZ” modification enhances the peptide’s resistance to enzymatic degradation (DPP-IV) and prolongs biological activity, making it a reliable model for advanced GI and metabolic research.


Mechanism of Action

  • Binds selectively to GLP-2 receptors (GLP-2R) in intestinal tissue.

  • Activates growth and repair signaling pathways (PI3K/Akt, IGF-1, and ERK1/2).

  • Increases enterocyte proliferation and villus height.

  • Reduces intestinal apoptosis and inflammatory cytokine expression.

  • Enhances nutrient uptake, barrier strength, and gut motility regulation.


Key Features

✅ ≥99% purity verified by HPLC & MS
✅ Long-acting, DPP-IV–resistant GLP-2 analog
✅ Promotes intestinal growth and epithelial repair (research context)
✅ Supports nutrient absorption and barrier function studies
✅ GMP-certified manufacturing and full COA documentation
✅ Large-scale 120mg pack ideal for institutional and advanced research use


Benefits (Research Context)

⚙️ Gut Regeneration Studies: Increases crypt cell proliferation and villus height.
⚙️ Mucosal Healing: Supports epithelial restitution and barrier restoration.
⚙️ Nutrient Absorption: Improves glucose, lipid, and amino acid uptake.
⚙️ Inflammatory Response Research: Modulates TNF-α and IL-6 pathways.
⚙️ Tight Junction Integrity: Enhances intestinal barrier cohesion in permeability models.


Applications / Uses (Research Only)

🔹 Gastrointestinal tissue growth and repair research
🔹 Nutrient transport and absorption studies
🔹 Inflammatory bowel disease (IBD) and gut injury models
🔹 Endocrine and enteric hormone signaling research
🔹 Epithelial regeneration and intestinal stem cell studies


Composition & Technical Data

Property Specification
Chemical Name GLP-2 “TZ” (Glucagon-Like Peptide-2 Analog)
Synonyms GLP-2 Synthetic Analog, Glucagon-Like Peptide-2 Mimetic
Sequence HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRG (stabilized analog)
CAS Number N/A (research analog)
Molecular Formula C₁₆₅H₂₆₃N₄₃O₅₅
Molecular Weight ~3760 g/mol
Appearance White to off-white lyophilized powder
Purity ≥99% (HPLC verified)
Solubility Soluble in sterile or bacteriostatic water
Form Lyophilized peptide (Research grade)
Storage Conditions –20 °C, dry and dark
Pack Size 120 mg vial

Dosage & Usage (Research Context)

  • Reconstitution: Dissolve in sterile or bacteriostatic water before use.

  • Recommended concentration: As determined by experimental protocol.

  • Storage after reconstitution: Store aliquots at –20 °C.

  • Handling: Avoid multiple freeze–thaw cycles to maintain peptide integrity.

  • Note: For in vitro and laboratory research use onlynot for injection or ingestion.


Storage & Stability

  • Store lyophilized GLP-2 “TZ” at –20 °C for up to 24 months.

  • After reconstitution, store at 2–8 °C and use within 30 days.

  • Protect from moisture, light, and temperature fluctuations.

  • Maintain sterile technique during all handling procedures.


Safety & Handling

  • Intended for scientific and laboratory research use only.

  • Not approved for human or veterinary use.

  • Avoid direct contact, inhalation, or ingestion.

  • Use gloves, goggles, and laboratory PPE.

  • Dispose of materials according to institutional biosafety regulations.


Why Buy from West Lab Chemicals?

🌐 High Purity Assurance: ≥99% verified by HPLC & MS.
🧪 GMP-Compliant Production: Ensures safety and batch consistency.
📄 Full Documentation: COA & MSDS provided with every order.
🚚 Global Delivery: Temperature-controlled worldwide shipping.
💬 Expert Support: Technical assistance for peptide storage and solubility.
💧 Trusted Worldwide: Preferred supplier for gastrointestinal and regenerative peptide studies.


Purity Guarantee

Each GLP-2 “TZ” 120mg vial from West Lab Chemicals is:

  • ≥99% pure (HPLC & MS verified)

  • Tested for endotoxins and microbial contamination

  • COA batch-certified and traceable

  • Manufactured under GMP & ISO 9001:2015 quality standards

Customer Reviews

0 reviews
0
0
0
0
0

There are no reviews yet.

Be the first to review “GLP-2 “TZ” 120mg”

Your email address will not be published. Required fields are marked *