GLP-2 “TZ” 15mg

Pricing & Availability

  • Product Code: WLC-GLP2TZ-15

  • Pack Size: 15 mg vial

  • Purity: ≥99% (HPLC verified)

  • Form: Lyophilized peptide (Research grade)

  • Availability: In Stock

  • MOQ: 1 vial

  • Shipping: 3–5 business days worldwide

📧 For bulk orders, OEM formulations, or institutional supply inquiries:
info@westlabchemicals.com

104.00 $

GLP-2 “TZ” 15mg | Glucagon-Like Peptide-2 Analog | Intestinal Repair & Regeneration Research 

GLP-2 “TZ” (Glucagon-Like Peptide-2 Analog) is a synthetic research peptide modeled after the natural hormone GLP-2, a potent regulator of intestinal mucosal growth, barrier integrity, and nutrient absorption.

At West Lab Chemicals, we supply GLP-2 “TZ” 15mg (Research Grade) with ≥99% purity (HPLC & MS verified), manufactured in GMP-certified facilities to ensure scientific reliability, purity, and stability.

This long-acting peptide analog is extensively used in gastrointestinal, metabolic, and mucosal biology research, helping scientists explore gut repair mechanisms, inflammatory bowel disease (IBD) models, and intestinal regeneration pathways.


What is GLP-2 “TZ”?

GLP-2 “TZ” is a synthetic analog of Glucagon-Like Peptide-2, a 33-amino acid hormone secreted by intestinal enteroendocrine L-cells in response to nutrient intake.

The “TZ” modification makes this peptide resistant to DPP-IV enzymatic degradation, significantly increasing its half-life and bioactivity compared to native GLP-2.

In research applications, GLP-2 “TZ” promotes intestinal cell proliferation, reduces apoptosis, and supports mucosal barrier recovery, making it a key peptide in gut and metabolic studies.


Mechanism of Action

  • Activates GLP-2 receptors (GLP-2R) on intestinal epithelial cells.

  • Stimulates crypt cell proliferation and increases villus height.

  • Enhances mucosal repair and tight junction strength.

  • Reduces inflammatory cytokine expression.

  • Promotes nutrient absorption and epithelial barrier integrity.


Key Features

✅ ≥99% purity verified by HPLC & Mass Spectrometry
✅ Long-acting GLP-2 analog with enhanced stability
✅ Supports gut epithelial regeneration and nutrient absorption research
✅ DPP-IV–resistant for extended peptide activity
✅ GMP-certified production with full COA and batch traceability
✅ Ideal 15mg pack for short- to mid-term gastrointestinal studies


Benefits (Research Context)

⚙️ Intestinal Regeneration: Increases epithelial proliferation and villus height.
⚙️ Mucosal Repair: Promotes wound closure and barrier recovery in gut models.
⚙️ Anti-Inflammatory Effects: Suppresses TNF-α and IL-6 activity in GI tissues.
⚙️ Nutrient Absorption: Enhances uptake of glucose, amino acids, and lipids.
⚙️ Gut Integrity Research: Strengthens tight junctions and mucosal resilience.


Applications / Uses (Research Only)

🔹 Intestinal growth and regeneration studies
🔹 Gut barrier and permeability research
🔹 Inflammatory bowel disease (IBD) and mucosal injury models
🔹 Endocrine and digestive signaling experiments
🔹 Nutrient transport and epithelial repair investigations


Composition & Technical Data

Property Specification
Chemical Name GLP-2 “TZ” (Glucagon-Like Peptide-2 Analog)
Synonyms GLP-2 Synthetic Analog, Glucagon-Like Peptide-2 Mimetic
Sequence HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRG (stabilized form)
CAS Number N/A (research analog)
Molecular Formula C₁₆₅H₂₆₃N₄₃O₅₅
Molecular Weight ~3760 g/mol
Appearance White to off-white lyophilized powder
Purity ≥99% (HPLC verified)
Solubility Soluble in sterile or bacteriostatic water
Form Lyophilized peptide (Research grade)
Storage Conditions –20 °C, dry and dark
Pack Size 15 mg vial

Dosage & Usage (Research Context)

  • Reconstitution: Dissolve in sterile or bacteriostatic water.

  • Recommended concentration: As required by study design.

  • Storage after reconstitution: Store aliquots at –20 °C.

  • Handling: Avoid multiple freeze–thaw cycles.

  • Note: For in vitro and laboratory research use onlynot for injection or ingestion.


Storage & Stability

  • Store lyophilized peptide at –20 °C for long-term stability.

  • After reconstitution, refrigerate (2–8 °C) and use within 30 days.

  • Protect from heat, light, and moisture.

  • Handle aseptically to maintain sample integrity.


Safety & Handling

  • Intended for scientific and laboratory research use only.

  • Not for human or veterinary use.

  • Avoid inhalation, ingestion, or skin contact.

  • Use laboratory PPE: gloves, coat, and eye protection.

  • Dispose of materials following institutional biosafety procedures.


Why Buy from West Lab Chemicals?

🌐 High Purity Assurance: ≥99% HPLC & MS confirmed.
🧪 GMP Manufacturing: Ensures consistency, sterility, and accuracy.
📄 Documentation Provided: COA & MSDS with each batch.
🚚 Worldwide Shipping: Temperature-controlled logistics.
💬 Expert Technical Support: Guidance for solubility, formulation, and storage.
💧 Trusted by Researchers: Used globally for intestinal and regenerative peptide research.


Purity Guarantee

Each vial of GLP-2 “TZ” 15mg from West Lab Chemicals undergoes:

  • ≥99% HPLC and Mass Spectrometry purity verification

  • Microbial and endotoxin testing

  • COA and batch traceability documentation

  • GMP & ISO 9001:2015 certified production

Customer Reviews

0 reviews
0
0
0
0
0

There are no reviews yet.

Be the first to review “GLP-2 “TZ” 15mg”

Your email address will not be published. Required fields are marked *