GLP-2 “TZ” 50mg

Pricing & Availability

  • Product Code: WLC-GLP2TZ-50

  • Pack Size: 50 mg vial

  • Purity: ≥99% (HPLC verified)

  • Form: Lyophilized peptide (Research grade)

  • Availability: In Stock

  • MOQ: 1 vial

  • Shipping: 3–5 business days worldwide

📧 For OEM labeling, bulk supply, or institutional inquiries:
info@westlabchemicals.com

219.99 $

GLP-2 “TZ” 50mg | Glucagon-Like Peptide-2 Analog | Intestinal Regeneration & Gut Barrier Research | West Lab Chemicals


Product Overview

GLP-2 “TZ” (Glucagon-Like Peptide-2 Analog) is a synthetic peptide analog of the natural hormone GLP-2, a critical regulator of intestinal growth, nutrient absorption, and mucosal repair.

At West Lab Chemicals, we offer GLP-2 “TZ” 50mg (Research Grade) with ≥99% purity (HPLC & MS verified), produced in GMP-certified peptide laboratories to ensure absolute purity, structural integrity, and biological consistency.

This long-acting analog is commonly used in gastrointestinal, metabolic, and mucosal biology research, where it facilitates studies related to intestinal epithelial regeneration, gut permeability, and enterocyte proliferation.


What is GLP-2 “TZ”?

GLP-2 “TZ” is a stabilized, synthetic form of Glucagon-Like Peptide-2 (GLP-2), a naturally secreted 33-amino acid hormone produced by intestinal L-cells in response to nutrient ingestion.

The “TZ” modification increases resistance to DPP-IV enzymatic degradation, extending its half-life and biological activity in research applications.

GLP-2 analogs like “TZ” are vital tools for exploring intestinal adaptation, tissue regeneration, and mucosal healing under controlled experimental conditions.


Mechanism of Action

  • Binds to GLP-2 receptors (GLP-2R) in intestinal epithelial and submucosal tissues.

  • Stimulates crypt cell proliferation and villus elongation.

  • Reduces apoptosis and supports epithelial repair.

  • Activates IGF-1 and PI3K/Akt pathways, enhancing tissue regeneration.

  • Strengthens intestinal barrier function and nutrient uptake.


Key Features

✅ ≥99% purity confirmed by HPLC & Mass Spectrometry
✅ Long-acting GLP-2 analog with superior stability
✅ Promotes epithelial regeneration and mucosal protection
✅ DPP-IV–resistant for extended bioactivity
✅ GMP-certified production with full documentation
✅ Convenient 50mg vial ideal for ongoing gastrointestinal studies


Benefits (Research Context)

⚙️ Intestinal Regeneration: Stimulates cell proliferation and crypt-villus growth.
⚙️ Mucosal Barrier Repair: Supports epithelial restoration and wound closure.
⚙️ Nutrient Absorption: Enhances glucose, amino acid, and lipid transport in GI models.
⚙️ Anti-Inflammatory Response: Reduces cytokine-induced tissue damage.
⚙️ Barrier Integrity: Strengthens tight junctions and mucosal resilience in research assays.


Applications / Uses (Research Only)

🔹 Gastrointestinal mucosal healing and tissue repair studies
🔹 Intestinal barrier and permeability experiments
🔹 IBD, Crohn’s, and enteric inflammation models
🔹 Nutrient absorption and metabolic regulation research
🔹 Endocrine and enteric signaling pathway studies


Composition & Technical Data

Property Specification
Chemical Name GLP-2 “TZ” (Glucagon-Like Peptide-2 Analog)
Synonyms GLP-2 Synthetic Analog, Glucagon-Like Peptide-2 Mimetic
Sequence HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRG (stabilized form)
CAS Number N/A (research analog)
Molecular Formula C₁₆₅H₂₆₃N₄₃O₅₅
Molecular Weight ~3760 g/mol
Appearance White to off-white lyophilized powder
Purity ≥99% (HPLC verified)
Solubility Soluble in sterile or bacteriostatic water
Form Lyophilized peptide (Research grade)
Storage Conditions –20 °C, dry and dark
Pack Size 50 mg vial

Dosage & Usage (Research Context)

  • Reconstitution: Dissolve in sterile or bacteriostatic water.

  • Working concentration: Determined by specific research design.

  • Storage after reconstitution: Keep at –20 °C and avoid repeated freeze–thaw cycles.

  • Note: For in vitro and laboratory research onlynot for injection or ingestion.


Storage & Stability

  • Store lyophilized peptide at –20 °C for up to 24 months.

  • Reconstituted peptide should be stored at 2–8 °C and used within 30 days.

  • Protect from light, moisture, and heat.

  • Always handle using aseptic laboratory techniques.


Safety & Handling

  • Intended for scientific research use only.

  • Not for human or veterinary administration.

  • Avoid inhalation, ingestion, or direct contact with skin.

  • Use gloves, safety goggles, and PPE when handling.

  • Dispose of materials according to institutional biosafety standards.


Why Buy from West Lab Chemicals?

🌐 Unmatched Purity: ≥99% verified via HPLC and MS testing.
🧪 GMP Production: Ensures sterility, consistency, and repeatability.
📄 Full Documentation: COA & MSDS provided with each batch.
🚚 Global Distribution: Temperature-controlled shipping available worldwide.
💬 Technical Support: Expert guidance on solubility, formulation, and storage.
💧 Trusted Worldwide: Used by researchers in regenerative and gastrointestinal studies.


Purity Guarantee

Each vial of GLP-2 “TZ” 50mg from West Lab Chemicals undergoes:

  • ≥99% purity verification by HPLC & MS

  • Endotoxin and sterility testing

  • COA batch traceability

  • GMP & ISO 9001:2015 certified manufacturing standards

Customer Reviews

0 reviews
0
0
0
0
0

There are no reviews yet.

Be the first to review “GLP-2 “TZ” 50mg”

Your email address will not be published. Required fields are marked *