GLP-2 “TZ” 50mg | Glucagon-Like Peptide-2 Analog | Intestinal Regeneration & Gut Barrier Research | West Lab Chemicals
Product Overview
GLP-2 “TZ” (Glucagon-Like Peptide-2 Analog) is a synthetic peptide analog of the natural hormone GLP-2, a critical regulator of intestinal growth, nutrient absorption, and mucosal repair.
At West Lab Chemicals, we offer GLP-2 “TZ” 50mg (Research Grade) with ≥99% purity (HPLC & MS verified), produced in GMP-certified peptide laboratories to ensure absolute purity, structural integrity, and biological consistency.
This long-acting analog is commonly used in gastrointestinal, metabolic, and mucosal biology research, where it facilitates studies related to intestinal epithelial regeneration, gut permeability, and enterocyte proliferation.
What is GLP-2 “TZ”?
GLP-2 “TZ” is a stabilized, synthetic form of Glucagon-Like Peptide-2 (GLP-2), a naturally secreted 33-amino acid hormone produced by intestinal L-cells in response to nutrient ingestion.
The “TZ” modification increases resistance to DPP-IV enzymatic degradation, extending its half-life and biological activity in research applications.
GLP-2 analogs like “TZ” are vital tools for exploring intestinal adaptation, tissue regeneration, and mucosal healing under controlled experimental conditions.
Mechanism of Action
-
Binds to GLP-2 receptors (GLP-2R) in intestinal epithelial and submucosal tissues.
-
Stimulates crypt cell proliferation and villus elongation.
-
Reduces apoptosis and supports epithelial repair.
-
Activates IGF-1 and PI3K/Akt pathways, enhancing tissue regeneration.
-
Strengthens intestinal barrier function and nutrient uptake.
Key Features
✅ ≥99% purity confirmed by HPLC & Mass Spectrometry
✅ Long-acting GLP-2 analog with superior stability
✅ Promotes epithelial regeneration and mucosal protection
✅ DPP-IV–resistant for extended bioactivity
✅ GMP-certified production with full documentation
✅ Convenient 50mg vial ideal for ongoing gastrointestinal studies
Benefits (Research Context)
⚙️ Intestinal Regeneration: Stimulates cell proliferation and crypt-villus growth.
⚙️ Mucosal Barrier Repair: Supports epithelial restoration and wound closure.
⚙️ Nutrient Absorption: Enhances glucose, amino acid, and lipid transport in GI models.
⚙️ Anti-Inflammatory Response: Reduces cytokine-induced tissue damage.
⚙️ Barrier Integrity: Strengthens tight junctions and mucosal resilience in research assays.
Applications / Uses (Research Only)
🔹 Gastrointestinal mucosal healing and tissue repair studies
🔹 Intestinal barrier and permeability experiments
🔹 IBD, Crohn’s, and enteric inflammation models
🔹 Nutrient absorption and metabolic regulation research
🔹 Endocrine and enteric signaling pathway studies
Composition & Technical Data
| Property | Specification |
|---|---|
| Chemical Name | GLP-2 “TZ” (Glucagon-Like Peptide-2 Analog) |
| Synonyms | GLP-2 Synthetic Analog, Glucagon-Like Peptide-2 Mimetic |
| Sequence | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRG (stabilized form) |
| CAS Number | N/A (research analog) |
| Molecular Formula | C₁₆₅H₂₆₃N₄₃O₅₅ |
| Molecular Weight | ~3760 g/mol |
| Appearance | White to off-white lyophilized powder |
| Purity | ≥99% (HPLC verified) |
| Solubility | Soluble in sterile or bacteriostatic water |
| Form | Lyophilized peptide (Research grade) |
| Storage Conditions | –20 °C, dry and dark |
| Pack Size | 50 mg vial |
Dosage & Usage (Research Context)
-
Reconstitution: Dissolve in sterile or bacteriostatic water.
-
Working concentration: Determined by specific research design.
-
Storage after reconstitution: Keep at –20 °C and avoid repeated freeze–thaw cycles.
-
Note: For in vitro and laboratory research only — not for injection or ingestion.
Storage & Stability
-
Store lyophilized peptide at –20 °C for up to 24 months.
-
Reconstituted peptide should be stored at 2–8 °C and used within 30 days.
-
Protect from light, moisture, and heat.
-
Always handle using aseptic laboratory techniques.
Safety & Handling
-
Intended for scientific research use only.
-
Not for human or veterinary administration.
-
Avoid inhalation, ingestion, or direct contact with skin.
-
Use gloves, safety goggles, and PPE when handling.
-
Dispose of materials according to institutional biosafety standards.
Why Buy from West Lab Chemicals?
🌐 Unmatched Purity: ≥99% verified via HPLC and MS testing.
🧪 GMP Production: Ensures sterility, consistency, and repeatability.
📄 Full Documentation: COA & MSDS provided with each batch.
🚚 Global Distribution: Temperature-controlled shipping available worldwide.
💬 Technical Support: Expert guidance on solubility, formulation, and storage.
💧 Trusted Worldwide: Used by researchers in regenerative and gastrointestinal studies.
Purity Guarantee
Each vial of GLP-2 “TZ” 50mg from West Lab Chemicals undergoes:
-
≥99% purity verification by HPLC & MS
-
Endotoxin and sterility testing
-
COA batch traceability
-
GMP & ISO 9001:2015 certified manufacturing standards

Reviews
Clear filtersThere are no reviews yet.