GLP-2 “TZ” 5mg

Pricing & Availability

  • Product Code: WLC-GLP2TZ-5

  • Pack Size: 5 mg vial

  • Purity: ≥99% (HPLC verified)

  • Form: Lyophilized peptide (Research grade)

  • Availability: In Stock

  • MOQ: 1 vial

  • Shipping: 3–5 business days worldwide

📧 For OEM manufacturing, institutional supply, or bulk order pricing:
info@westlabchemicals.com

59.99 $

GLP-2 “TZ” 5mg | Glucagon-Like Peptide-2 Analog | Intestinal Regeneration & Gut Barrier Research 

GLP-2 “TZ” (Glucagon-Like Peptide-2 Analog) is a synthetic peptide analog designed to mimic the biological activity of the natural intestinal hormone GLP-2, which plays a critical role in gut mucosal growth, nutrient absorption, and intestinal barrier repair.

At West Lab Chemicals, we provide GLP-2 “TZ” 5mg (Research Grade) with ≥99% purity (HPLC & MS verified), produced in GMP-certified laboratories for consistency, purity, and reproducibility.

This peptide is used in gastrointestinal, mucosal, and metabolic research to study enterocyte proliferation, villus regeneration, and intestinal barrier function under controlled laboratory conditions.


What is GLP-2 “TZ”?

GLP-2 “TZ” is a synthetic analog of Glucagon-Like Peptide-2 (GLP-2), a 33-amino acid peptide hormone naturally secreted by enteroendocrine L-cells of the small intestine in response to nutrient intake.

The “TZ” version is structurally enhanced to resist DPP-IV enzymatic degradation, making it more stable and longer-acting in research applications.

GLP-2 “TZ” acts on GLP-2 receptors (GLP-2R) in intestinal tissue to stimulate epithelial repair, crypt-villus growth, and nutrient transport, while also reducing inflammatory cytokine expression.


Mechanism of Action

  • Activates GLP-2R receptors in intestinal epithelial cells.

  • Stimulates crypt cell proliferation and villus elongation.

  • Enhances mucosal healing and barrier integrity.

  • Suppresses pro-inflammatory cytokines (TNF-α, IL-6).

  • Improves nutrient absorption and gut homeostasis.


Key Features

✅ ≥99% purity verified via HPLC & MS
✅ Long-acting GLP-2 analog with superior bioavailability
✅ Promotes epithelial regeneration and barrier strength (research context)
✅ DPP-IV–resistant structure for longer half-life
✅ GMP-certified manufacturing for reliability and reproducibility
✅ 5mg vial — ideal for pilot or small-scale GI research projects


Benefits (Research Context)

⚙️ Intestinal Regeneration: Promotes enterocyte proliferation and villus height increase.
⚙️ Barrier Function: Enhances mucosal tight junction integrity.
⚙️ Mucosal Healing: Supports epithelial restoration after injury.
⚙️ Anti-Inflammatory Effects: Reduces inflammation in GI tissue models.
⚙️ Nutrient Absorption: Improves absorption and utilization in gut research studies.


Applications / Uses (Research Only)

🔹 Gastrointestinal mucosal healing and regeneration studies
🔹 Intestinal permeability and nutrient uptake research
🔹 Inflammatory bowel disease (IBD) models
🔹 Endocrine signaling and enteric peptide studies
🔹 Epithelial cell repair and regeneration research


Composition & Technical Data

Property Specification
Chemical Name GLP-2 “TZ” (Glucagon-Like Peptide-2 Analog)
Synonyms GLP-2 Synthetic Analog, Glucagon-Like Peptide-2 Mimetic
Sequence HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRG (stabilized)
CAS Number N/A (research analog)
Molecular Formula C₁₆₅H₂₆₃N₄₃O₅₅
Molecular Weight ~3760 g/mol
Appearance White to off-white lyophilized powder
Purity ≥99% (HPLC verified)
Solubility Soluble in sterile or bacteriostatic water
Form Lyophilized peptide (Research grade)
Storage Conditions –20 °C, dry and dark
Pack Size 5 mg vial

Dosage & Usage (Research Context)

  • Reconstitution: Dissolve in sterile or bacteriostatic water before use.

  • Recommended concentration: Based on experimental requirements.

  • Storage after reconstitution: Store aliquots at –20 °C.

  • Handling: Avoid multiple freeze–thaw cycles.

  • Note: For in vitro and laboratory research onlynot for injection or ingestion.


Storage & Stability

  • Lyophilized peptide: Stable for up to 24 months at –20 °C.

  • After reconstitution: Store at 2–8 °C, stable for up to 30 days.

  • Protect from light, heat, and moisture.

  • Handle using aseptic laboratory procedures.


Safety & Handling

  • For laboratory and scientific research use only.

  • Not for human or veterinary administration.

  • Avoid inhalation, ingestion, or direct contact.

  • Use standard PPE: gloves, lab coat, and eye protection.

  • Dispose of materials following institutional biosafety protocols.


Why Buy from West Lab Chemicals?

🌐 Ultra-High Purity: ≥99% verified by HPLC & MS.
🧪 GMP-Certified Production: Consistent, sterile, and reliable batches.
📄 Comprehensive Documentation: COA & MSDS provided with every order.
🚚 Global Shipping: Temperature-controlled, tracked international delivery.
💬 Expert Technical Support: Guidance on peptide solubility, storage, and usage.
💧 Trusted Worldwide: Used by researchers in gut regeneration, IBD, and nutrient transport studies.


Purity Guarantee

Every batch of GLP-2 “TZ” 5mg from West Lab Chemicals undergoes:

  • ≥99% purity verification (HPLC & MS)

  • Endotoxin and microbial contamination testing

  • Batch traceability and COA validation

  • GMP & ISO 9001:2015 manufacturing compliance

Customer Reviews

0 reviews
0
0
0
0
0

There are no reviews yet.

Be the first to review “GLP-2 “TZ” 5mg”

Your email address will not be published. Required fields are marked *