LL-37 10mg – Premium Antimicrobial Research Peptide
LL-37 10mg is a synthetic, high-purity antimicrobial peptide (AMP) belonging to the cathelicidin family, supplied by West Lab Chemicals for professional research and biochemical studies.
This peptide plays a vital role in the body’s innate immune defense system, with notable applications in antimicrobial, wound healing, and immunomodulatory research. Every vial of LL-37 10mg is verified for purity and molecular identity using HPLC and LC-MS analytical methods, ensuring consistency and reliability across experiments.
What is LL-37?
LL-37, also known as Human Cathelicidin Antimicrobial Peptide (hCAP-18), is the only cathelicidin-derived peptide identified in humans. It is naturally produced by white blood cells and epithelial cells as part of the body’s first line of defense against pathogens.
In research, LL-37 is used to explore its broad-spectrum antimicrobial effects and its ability to modulate immune signaling, stimulate angiogenesis, and accelerate tissue repair. Because of these properties, it has become an essential compound in inflammation, infection control, and wound-healing studies.
Key Features
✅ High Purity (≥99%) – Verified by HPLC and LC-MS for sequence and molecular integrity.
✅ Biologically Active Sequence – Synthetic equivalent of human cathelicidin LL-37.
✅ Research Grade Quality – Supplied exclusively for in-vitro and laboratory use.
✅ Stable Lyophilized Form – Ensures extended shelf life under recommended conditions.
✅ Globally Shipped – Secure, temperature-controlled packaging for safe delivery.
Scientific Applications
LL-37 10mg is used extensively across multiple biochemical research domains, including:
-
Antimicrobial Studies: Investigation of LL-37’s ability to disrupt bacterial membranes and inhibit microbial growth.
-
Immunology Research: Understanding its effects on cytokine modulation and immune system signaling.
-
Wound Healing Models: Studying tissue regeneration and angiogenesis.
-
Inflammation Research: Exploring anti-inflammatory responses in epithelial and immune cell lines.
-
Cancer Research: Examining LL-37’s potential role in cell proliferation and apoptosis pathways.
Benefits for Researchers
-
Provides consistent and reproducible results across biological assays.
-
Allows exploration of natural immune peptides and pathogen resistance mechanisms.
-
Highly pure and stable compound for long-term storage and repeated use.
-
Compatible with a variety of in-vitro and ex-vivo experimental designs.
Handling & Storage
-
Form: Lyophilized white powder
-
Storage Temperature: 2–8 °C (short-term); –20 °C (long-term)
-
Reconstitution: Dissolve in sterile water or appropriate research buffer under aseptic conditions.
-
Shelf Life: Up to 24 months under ideal storage conditions.
-
Safety Note: Handle with standard laboratory PPE. Avoid inhalation or contact with skin and eyes.
Why Buy LL-37 10mg from West Lab Chemicals
At West Lab Chemicals, we are dedicated to supplying authentic, high-purity peptides to the global scientific community. When you purchase LL-37 10mg, you receive:
-
Certificate of Analysis (COA) – Each batch verified for purity, identity, and stability.
-
ISO-Compliant Manufacturing Standards – Ensures safety and reliability.
-
Global Distribution Network – Fast, discreet, and professional delivery.
-
Technical Support – Expert team available for documentation and research guidance.
-
Affordable Bulk Options – Custom order volumes for institutions and laboratories.
Purity & Quality Assurance
Every batch of LL-37 10mg undergoes comprehensive testing to meet strict research-grade specifications:
-
HPLC chromatographic purity ≥99%
-
LC-MS sequence verification
-
Endotoxin and sterility testing (as required)
-
Traceability and batch documentation included
-
Manufactured under quality-controlled laboratory conditions
Legal & Research Disclaimer
LL-37 10mg is supplied strictly for research and laboratory use only.
It is not intended for human consumption, medical use, or therapeutic application.
All customers must ensure compliance with applicable local and institutional regulations regarding peptide handling and research usage.
Technical Specifications
| Property | Description |
|---|---|
| Product Name | LL-37 10mg |
| Synonyms | Cathelicidin Antimicrobial Peptide (hCAP-18) |
| Sequence | [LL-37, 37 aa] |
| Molecular Formula | C₂₁₅H₃₆₅N₆₅O₄₅ |
| Molecular Weight | ~4493.3 g/mol |
| Purity | ≥99% (HPLC Verified) |
| Appearance | White to off-white lyophilized powder |
| Solubility | Soluble in sterile water or PBS |
| Storage | 2–8 °C (short-term), –20 °C (long-term) |
| Intended Use | Laboratory research only |

Reviews
Clear filtersThere are no reviews yet.