MGF IGF-1ECE 5mg
MGF IGF-1Ec 5mg (Mechano Growth Factor) is a synthetic peptide designed for advanced biochemical and muscle regeneration research. It represents the IGF-1 splice variant (Insulin-like Growth Factor-1 Ec), which has been shown to play a vital role in tissue repair, muscle recovery, and cellular growth processes.
At West Lab Chemicals, our MGF IGF-1Ec is manufactured under stringent laboratory conditions to ensure ≥99% purity, sequence validation, and batch traceability. Every vial is supplied as a stable lyophilized peptide, ready for reconstitution in sterile conditions.
What is MGF (IGF-1Ec)?
MGF (Mechano Growth Factor), also known as IGF-1Ec, is a naturally occurring splice variant of Insulin-like Growth Factor-1 (IGF-1) produced in response to mechanical overload or muscle damage. It is particularly active in skeletal muscle tissue, where it promotes satellite cell activation, protein synthesis, and tissue repair.
In laboratory settings, MGF IGF-1Ec is utilized to study:
-
The molecular mechanisms of muscle hypertrophy,
-
Cellular regeneration, and
-
Signal transduction involved in growth factor pathways.
Its short-term local expression and unique biological profile distinguish it from standard IGF-1, making it a crucial peptide in regenerative and growth-related biochemical research.
Key Features
✅ High Purity (≥99%) – Tested using HPLC and LC-MS for structural integrity.
✅ Stable Lyophilized Form – Long shelf life when stored under recommended conditions.
✅ Research Grade Quality – Intended strictly for laboratory and in-vitro research.
✅ Validated Sequence – Synthetic peptide matching the human IGF-1Ec isoform.
✅ Global Availability – Secure, temperature-controlled international shipping.
Scientific Applications
MGF IGF-1Ec 5mg is widely used in research areas such as:
-
Muscle Regeneration Studies: Understanding MGF’s impact on myoblast activation and differentiation.
-
Cellular Growth Research: Studying IGF-related pathways in tissue regeneration.
-
Signal Transduction Mechanisms: Examining receptor activation and intracellular protein signaling cascades.
-
Wound Healing and Recovery Models: Exploring cellular repair and recovery dynamics.
-
Biomedical Peptide Research: Developing insights into muscle cell adaptation and protein metabolism.
Benefits for Researchers
-
Facilitates reproducible results in muscle and cell growth studies.
-
Offers high molecular stability and rapid reconstitution.
-
Ensures reliable analytical data with verified purity.
-
Compatible with cell culture and peptide receptor assay systems.
Handling & Storage
-
Form: Lyophilized peptide powder
-
Storage: 2–8 °C (short-term) or –20 °C (long-term)
-
Reconstitution: Dissolve in sterile water or suitable buffer under aseptic conditions.
-
Shelf Life: 24 months under recommended conditions.
-
Safety: Use protective gloves and eyewear; handle in a laboratory environment only.
Why Buy from West Lab Chemicals
West Lab Chemicals is a trusted global supplier of research-grade peptides and biochemical compounds. Every unit of MGF IGF-1Ec 5mg is backed by professional quality assurance and analytical validation.
When you purchase from us, you receive:
-
Certificate of Analysis (COA) – Verification of purity and identity.
-
HPLC & LC-MS Reports – Ensures accurate peptide structure.
-
Batch Traceability – Every vial linked to validated lot records.
-
Affordable Research Pricing – Competitive rates for academic and institutional orders.
-
Dedicated Support – Expert team available for product and documentation assistance.
Purity & Quality Assurance
Each batch of MGF IGF-1Ec 5mg undergoes rigorous analytical testing, including:
-
HPLC Analysis: ≥ 99% purity verification.
-
Mass Spectrometry: Confirms molecular sequence and weight.
-
Sterility Screening: Ensures suitability for in-vitro environments.
-
COA Documentation: Provided with all orders for regulatory compliance.
All products are produced in ISO-compliant laboratories under strict quality management systems.
Legal & Research Disclaimer
MGF IGF-1Ec 5mg is supplied strictly for laboratory research use only.
It is not intended for human or animal consumption, medical, or therapeutic applications.
All handling and disposal must follow standard laboratory safety and regulatory protocols.
Technical Specifications
| Property | Description |
|---|---|
| Product Name | MGF IGF-1Ec 5mg |
| Synonyms | Mechano Growth Factor, IGF-1Ec |
| Sequence | YQPPSTNKNTKSQRRKGSTFEEHKHNPPKSP |
| Molecular Formula | C₁₅₃H₂₄₆N₄₆O₄₂ |
| Molecular Weight | ~2879.2 g/mol |
| Purity | ≥ 99% (HPLC Verified) |
| Appearance | White lyophilized powder |
| Solubility | Water or phosphate buffer solution |
| Storage Conditions | 2–8 °C (short-term), –20 °C (long-term) |
| Intended Use | Laboratory research only |

Reviews
Clear filtersThere are no reviews yet.