PEG-MGF (Pegylated Mechano Growth Factor) is a synthetic derivative of the IGF-1Ec splice variant, designed for advanced muscle regeneration and cellular repair research. The addition of a polyethylene glycol (PEG) chain enhances peptide stability and prolongs biological activity in research environments.
At West Lab Chemicals, we supply PEG-MGF 2mg as a research-grade lyophilized peptide with ≥99% purity, verified using HPLC and LC-MS analytical methods. Each vial is shipped with a Certificate of Analysis (COA) to ensure full transparency and traceability.
What is PEG-MGF?
PEG-MGF (Pegylated Mechano Growth Factor) is a modified form of MGF (IGF-1Ec) — a naturally occurring Insulin-like Growth Factor-1 variant expressed in response to mechanical stress or muscle injury.
While native MGF has a short half-life, the PEGylated modification dramatically increases its stability and duration of activity, allowing for extended effects in cellular and muscle tissue studies.
In research, PEG-MGF is studied for its potential to:
-
Promote satellite cell activation and muscle regeneration
-
Enhance protein synthesis and cell growth
-
Support tissue recovery following injury or stress
-
Regulate growth signaling pathways (e.g., IGF and Akt pathways)
Key Features
✅ High Purity (≥99%) – Verified via HPLC and LC-MS testing
✅ PEGylated Structure – Enhanced peptide half-life and molecular stability
✅ Research Grade Only – Suitable strictly for laboratory and in-vitro studies
✅ Stable Lyophilized Form – Long-term shelf life under proper storage
✅ COA Included – Each vial supplied with analytical documentation
Scientific Applications
PEG-MGF 2mg is commonly used in the following areas of biochemical and physiological research:
-
Muscle Growth & Repair Studies: Investigating cellular regeneration and recovery after mechanical load or injury.
-
Protein Synthesis Research: Studying anabolic signaling via IGF-1 pathways.
-
Cellular Metabolism: Examining the peptide’s influence on cell proliferation and differentiation.
-
Tissue Engineering: Assessing regenerative potential in muscle and connective tissues.
-
Molecular Stability Models: Understanding the impact of PEGylation on peptide pharmacokinetics.
Benefits for Researchers
-
Prolonged activity and improved molecular stability versus native MGF
-
Reliable, reproducible results across experiments
-
Manufactured under strict quality and purity controls
-
Supplied with batch traceability and COA for full research documentation
-
Compatible with multiple in-vitro experimental systems
Handling & Storage
-
Form: Lyophilized peptide powder
-
Storage Conditions: 2–8 °C (short-term); –20 °C (long-term)
-
Reconstitution: Reconstitute with sterile water or phosphate-buffered saline (PBS) under aseptic conditions
-
Shelf Life: 24 months under recommended storage
-
Safety: Laboratory research use only. Avoid contact or inhalation. Use appropriate PPE.
Why Buy PEG-MGF from West Lab Chemicals
At West Lab Chemicals, we specialize in supplying high-purity research peptides to global laboratories and institutions. Each peptide, including PEG-MGF 2mg, is produced under strict ISO-certified conditions to ensure exceptional purity and consistency.
When purchasing from us, you receive:
-
≥99% purity guarantee (HPLC verified)
-
Certificate of Analysis (COA) and batch traceability
-
ISO 9001 and GMP-equivalent laboratory production
-
Competitive research pricing and bulk availability
-
Fast, discreet international shipping
-
Technical assistance for documentation or handling inquiries
Purity & Quality Assurance
Every batch of PEG-MGF 2mg is rigorously tested to confirm:
-
HPLC purity ≥99%
-
Mass spectrometry validation for molecular sequence
-
Sterility and endotoxin screening (as required)
-
Batch documentation and traceability certification
-
Final QC verification prior to dispatch
Manufactured in ISO 9001-certified, GMP-equivalent peptide facilities.
Legal & Research Disclaimer
PEG-MGF 2mg is intended strictly for laboratory research use only.
It is not intended for human or veterinary consumption, nor for medical or therapeutic applications.
All users must comply with institutional and local laboratory safety regulations when handling this product.
Technical Specifications
| Property | Description |
|---|---|
| Product Name | PEG-MGF (Pegylated Mechano Growth Factor) |
| Quantity | 2mg |
| Sequence | YQPPSTNKNTKSQRRKGSTFEEHKHNPPKSP (PEG modified) |
| Molecular Formula | C₁₅₃H₂₄₆N₄₆O₄₂ + PEG |
| Molecular Weight | ~3330 g/mol (approx., PEGylated) |
| Purity | ≥99% (HPLC Verified) |
| Appearance | White lyophilized powder |
| Solubility | Soluble in sterile water or PBS |
| Storage Conditions | 2–8 °C (short-term), –20 °C (long-term) |
| Intended Use | Laboratory research only |

Reviews
Clear filtersThere are no reviews yet.